explainerbeginner
The Marketing Skills That Matter Now: What AI Made Valuable and What It Made Cheap
AI repriced the marketing skill market. An honest inventory of which capabilities gained value, which collapsed, and how to reposition — for individuals and for hiring managers.
careersskillshiringmarketing leader
explainerbeginner
The State of AI Marketing, Mid-2026: What's Real, What's Noise, What's Next
A clear-eyed mid-year assessment of AI in marketing: which capabilities crossed into production, which promises stalled, and where the next twelve months are heading.
state-of-industrystrategyagentsmarketing leader
guideintermediate
AI for B2B Marketing: Where It Actually Works
B2B's long cycles, small audiences, and committee buying change what AI is good for. A practical map of the B2B use cases that pay off — and the B2C imports that don't.
b2babmlead-generationgrowth marketer
guidebeginner
AI Image Generation for Marketers: A Working Playbook
Where AI image generation genuinely works in marketing, where it embarrasses brands, and the brief-to-asset process that keeps quality and consistency high.
image-generationcreativedesigncontent marketer
workflowbeginner
Webinar-to-Everything: The AI Repurposing Workflow for Events
Turn one webinar or event session into a month of content — recap article, clips, social posts, email sequence, and FAQ — with AI handling the transformation.
webinarrepurposingeventscontent marketer
tool-analysisbeginner
Perplexity for Marketers: The Research Tool and the Visibility Channel
Perplexity matters to marketers twice — as a daily research tool with citations built in, and as an answer surface where your brand is either present or absent.
perplexityresearchgeocontent marketer
glossary
Synthetic Data
Synthetic data is artificially generated data that mimics real data's patterns — used in marketing for testing, privacy-safe analysis, and simulated audience research.
synthetic-dataresearchprivacyanalytics lead
roundupbeginner
This Week in AI Marketing #11: The Mid-Year Reality Check
A mid-2026 stocktake: what actually changed in AI marketing this half, what was noise, and the one capability gap that will define H2.
weekly-roundupai-strategymid-year-reviewmarketing leader
explainerintermediate
Buy vs Build: The Marketing Agent Decision, Honestly
Should your team buy packaged AI agent products or build on frameworks and automation platforms? A decision framework based on what actually predicts success.
agentsstrategytoolingmarketing leader
tool-analysisbeginner
AI Research Tools for Marketers: Deep Research, Notebooks, and Where Each Fits
A practical guide to AI research tooling for marketing — deep research agents, NotebookLM-style workspaces, and Perplexity — and how to use them without inheriting their errors.
ai-researchnotebooklmdeep-researchcontent marketer
guideintermediate
AI-Powered Competitor Analysis: From Monthly Chore to Living System
How to use AI to run continuous competitor intelligence — positioning shifts, pricing changes, content strategy, and AI-answer presence — without a research team.
competitive-intelligenceagentsresearchgrowth marketer
workflowintermediate
Build a Lead Enrichment Agent That Prioritizes Your Pipeline
Set up an AI agent that automatically researches every new lead, fills in firmographic and intent context, scores fit, and routes the best ones to sales with a briefing.
lead-enrichmentai-agentslead-scoringmarketing ops manager
roundupbeginner
This Week in AI Marketing #10: When Your Visitor Is a Bot (and That's Fine)
Agent traffic becomes a real audience segment, plus notes on machine-readable pages, analytics hygiene, and agent-friendly conversion paths.
ai-agentsweekly-roundupagent-trafficanalytics lead
glossarybeginner
Context Window
A context window is the amount of text an AI model can consider at once — the working memory that limits how much brand, data, and campaign context you can supply.
context-windowllm-basicsdefinitionscontent marketer
explainerintermediate
AI Marketing Metrics That Matter: Measuring the Machine-Era Program
The metrics that actually capture AI's impact on marketing — from AI-answer visibility share to workflow unit costs — and the vanity numbers to retire.
marketing-metricsmeasurementai-visibilityanalytics lead
trend-notebeginner
Agentic Commerce Rising
AI agents that research, compare, and buy on a user's behalf are emerging — and they change who marketing actually has to persuade.
agentic-commerceai-agentsecommercegrowth marketer
tool-analysisintermediate
CrewAI for Marketing Teams: Multi-Agent Workflows Beyond the Demo
An honest analysis of CrewAI for marketing teams — what the multi-agent 'crews' framework actually delivers, what it costs, and who should adopt it.
crewaimulti-agentagentic-workflowmarketing ops manager
workflowadvanced
The AI Paid Ads Creative Testing Loop: Generate, Test, Learn, Repeat
An advanced closed-loop system where AI generates ad creative variants from a concept matrix, structured tests pick winners, and performance data trains the next generation round.
paid-adscreative-testingad-creativepaid media specialist
roundupbeginner
This Week in AI Marketing #09: Lifecycle Gets a Brain
AI moves into lifecycle and CRM marketing — adaptive sends, generated segments, and the new discipline of reviewing what the model decided.
lifecycle-marketingweekly-roundupcrmcrm lifecycle marketer
glossarybeginner
Agentic Workflow
An agentic workflow is an AI process where a model plans, uses tools, and iterates toward a goal — deciding its own steps rather than following a fixed script.
agentic-workflowai-agentsautomationmarketing ops manager
guideintermediate
Building Your First Marketing Agent: A Step-by-Step Guide
A practical walkthrough for shipping your first AI marketing agent — a no-code path and a code path, with scoping advice, guardrails, and a realistic timeline.
ai-agentsno-codeagent-buildingmarketing ops manager
tool-analysisintermediate
AI Ad Creative Tools in 2026: Volume Is Solved, Judgment Isn't
A working review of the AI ad creative stack — generation, iteration, and pre-flight testing tools — and how paid teams should actually deploy them.
ad-creativepaid-mediacreative-testingpaid media specialist
learning-pathintermediate
Paid Media AI Path: From Campaign Manager to AI-Leveraged Buyer
A staged path for paid media specialists: work with platform automation instead of against it, build an AI creative engine, and automate analysis and reporting.
paid-mediaad-creativecreative-testingpaid media specialist
guideintermediate
AI in Paid Media: Creative Generation, Bidding, and Testing That Works
How paid media teams use AI across creative generation, automated bidding, and testing in 2026 — what to automate, what to keep human, and where budgets leak.
paid-mediaad-creativeautomated-biddingpaid media specialist
workflowbeginner
Video Repurposing Workflow: One Long Video Into 15 Assets
A step-by-step workflow for turning a single webinar, podcast, or long-form video into clips, shorts, social posts, and an article using AI tools — in about two hours.
video-repurposingshort-form-videocontent-atomizationcontent marketer
tool-analysisbeginner
Claude vs ChatGPT for Marketing Work: An Honest Comparison
Where Claude and ChatGPT each genuinely excel for marketing tasks — writing, research, analysis, and workflow — without fanboy scoring.
claudechatgptai-assistantscontent marketer
learning-pathbeginner
The AI Video & Creative Path
A staged learning path for marketers building AI-powered video and creative production: from first generations to a repeatable creative pipeline.
videocreativelearning-pathcontent marketer
explainerintermediate
Is the Marketing Funnel Dead? What AI Answers Actually Compress
AI answers collapse the research phase of buying journeys. What that compression really means for funnel strategy — and what survives it.
marketing-funnelbuyer-journeyai-searchmarketing leader
trend-notebeginner
Synthetic Personas in Market Research
AI-simulated customer personas are entering the research workflow — fast and cheap for early exploration, risky as a substitute for real customers.
synthetic-personasmarket-researchai-agentsgrowth marketer
explainerintermediate
Personalization at Scale Finally Works. Here's What It Actually Takes.
AI made one-to-one personalization technically possible. The teams making it work treat it as a data and governance problem, not a copy problem.
personalizationsegmentationdatacrm lifecycle marketer
workflowintermediate
Social Listening Agent: From Mentions to Actions Automatically
Build an AI agent that monitors brand mentions and sentiment across social platforms and communities, classifies what matters, and routes each mention to the right action.
social-listeningsentiment-analysisai-agentssocial media manager
tool-analysisintermediate
AI Analytics Copilots for Marketing: What They Answer and What They Get Wrong
An honest look at AI analytics copilots for marketing teams — where natural-language querying delivers, where it hallucinates, and how to adopt without breaking trust in your data.
analyticsai-copilotsmarketing-dataanalytics lead
workflowintermediate
The Self-Improving Email Nurture Loop
Build an email nurture sequence that rewrites itself: AI drafts variants, engagement data picks winners, and the losers get replaced automatically every cycle.
email-marketingnurture-sequencesmarketing-loopscrm lifecycle marketer
roundupbeginner
This Week in AI Marketing #07: Workflows Beat Prompts
Marketing automation rebuilds around AI-native workflows, plus notes on context management, connector sprawl, and a stat on time reclaimed.
marketing-automationweekly-roundupworkflowsmarketing ops manager
trend-notebeginner
Zero-Click Marketing
When AI answers satisfy the query, the answer itself becomes the touchpoint — and marketing has to work without the visit.
zero-clickai-searchbrand-visibilitycontent marketer
workflowintermediate
The GEO Content Optimization Workflow: Audit, Fix, Verify
A repeatable workflow for auditing your existing content's visibility in AI answers and systematically optimizing it for citation in ChatGPT, Perplexity, and Google AI Overviews.
geoaeocontent-optimizationseo geo strategist
tool-analysisintermediate
n8n vs Make vs Zapier for AI Marketing Workflows
A head-to-head comparison of n8n, Make, and Zapier for building AI-powered marketing automations — pricing models, AI capabilities, and which teams should pick which.
n8nmakezapiermarketing ops manager
glossarybeginner
Prompt Engineering
Prompt engineering is the practice of designing inputs to AI models — context, examples, instructions, and constraints — to reliably produce useful, on-brand outputs.
prompt-engineeringllm-basicsdefinitionscontent marketer
guidebeginner
Prompt Engineering for Marketers: Patterns That Actually Work
Practical prompt patterns for marketing tasks — briefs, rewrites, analysis, and campaign ideation — with copy-paste templates and the mistakes to avoid.
prompt-engineeringai-contentproductivitycontent marketer
learning-pathbeginner
AI Social Path: Becoming an AI-Powered Social Media Manager
A staged learning path for social media managers who want to use AI across ideation, creation, scheduling, listening, and reporting — without their channels going generic.
social-mediaai-toolscontent-creationsocial media manager
trend-notebeginner
Browser Agents and Marketing
AI agents that browse the web on users' behalf are redefining what a 'visitor' is — and what websites must do to convert one.
browser-agentsai-agentsweb-analyticsanalytics lead
guidebeginner
AI Email Marketing: A Practical Guide to the Whole Program
How to apply AI across your email program — ideation, copy, personalization, send-time, deliverability, and reporting — with realistic expectations at each step.
email-marketingai-copywritingpersonalizationcrm lifecycle marketer
workflowintermediate
Build a Weekly Competitor Intel Agent That Actually Gets Read
Set up an AI agent that monitors competitor websites, pricing, ads, and content every week and delivers a short brief of what changed and why it matters.
competitive-intelligenceai-agentsmonitoringgrowth marketer
roundupbeginner
This Week in AI Marketing #05: Social Teams Become Media Labs
AI is turning small social teams into full media operations, plus notes on comment intelligence, format testing, and creator disclosure norms.
ai-social-mediaweekly-roundupshort-form-videosocial media manager
glossarybeginner
Marketing Loops
Marketing loops are self-improving AI workflows that feed performance results back into the next run, so campaigns learn and improve automatically over time.
marketing-loopsai-workflowsdefinitionsmarketing ops manager
guideintermediate
Marketing Loops: Building Self-Improving AI Workflows
Marketing loops are AI workflows that feed performance data back into the next run, so campaigns improve automatically. Here's how to design and ship your first one.
marketing-loopsai-workflowsautomationmarketing ops manager
learning-pathintermediate
Agent Builder Path: From Marketer to Marketing Agent Builder
A staged path for marketers who want to go beyond prompting and actually build AI agents that monitor, research, and act on marketing tasks autonomously.
ai-agentsautomationagent-buildingmarketing ops manager
explainerbeginner
The Small-Team AI Stack: Lean Tooling for Marketing Teams Under 10
A pragmatic blueprint for the AI stack of a sub-10-person marketing team — what to buy, what to skip, and how to sequence adoption without drowning in tools.
ai-stacksmall-teamsmartechgrowth marketer
glossarybeginner
Answer Engine Optimization (AEO)
AEO is the practice of structuring content so AI answer engines like ChatGPT, Perplexity, and Google AI Overviews select and cite it as a source in their responses.
aeoai-citationsdefinitionsseo geo strategist
guidebeginner
AEO: How to Get Cited by AI Answer Engines
Answer Engine Optimization (AEO) is the craft of earning citations in AI-generated answers. Learn the tactics that get your pages quoted by ChatGPT, Perplexity, and AI Overviews.
aeoai-citationsanswer-enginesseo geo strategist
tool-analysisbeginner
AI Email Marketing Tools in 2026: What's Real Behind the 'AI-Powered' Label
A clear-eyed guide to AI features in email marketing platforms — which capabilities move revenue, which are demo-ware, and how to evaluate the 2026 field.
email-marketingai-copywritinglifecycle-marketingcrm lifecycle marketer
learning-pathbeginner
GEO Mastery Path: From Zero to AI Search Practitioner
A staged learning path that takes you from understanding what generative engine optimization is to running a full GEO program with measurement, optimization, and reporting.
geoaeoai-searchseo geo strategist
workflowbeginner
The AI Blog Writing Workflow: Brief to Publish Without the Slop
A five-stage blog production workflow that uses AI at the brief, research, draft, edit, and publish stages — while keeping a human editor in charge of quality.
blog-writingcontent-productioneditingcontent marketer
roundupbeginner
This Week in AI Marketing #03: Agents Get a Job Description
Marketing teams are moving from AI chat to AI agents with defined scopes, plus notes on approval workflows and agent-readable content.
ai-agentsweekly-roundupmarketing-opsmarketing ops manager